HORDB

ID: hor002163
Uniprot ID: P10764
Protein name: Preptin
Gene name: IGF2
Organism: Ovis aries (Sheep)
Family: Insulin family
Source: Animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Ovis (genus), Caprinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005178 integrin binding; GO:0005179 hormone activity; GO:0008083 growth factor activity
GO BP: GO:0000122 negative regulation of transcription by RNA polymerase II; GO:0001503 ossification; GO:0001701 in utero embryonic development; GO:0001892 embryonic placenta development; GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0007165 signal transduction; GO:0008284 positive regulation of cell population proliferation; GO:0051147 regulation of muscle cell differentiation; GO:0051148 negative regulation of muscle cell differentiation; GO:0051781 positive regulation of cell division; GO:0060669 embryonic placenta morphogenesis
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence: DVSASTTVLPDDFTAYPVGKFFQSDTWKQSTQRL
Length: 34(93-126)
Propeptide: MGITAGKSMLALLAFLAFASCCYAAYRPSETLCGGELVDTLQFVCGDRGFYFSRPSSRINRRSRGIVEECCFRSCDLALLETYCAAPAKSERDVSASTTVLPDDFTAYPVGKFFQSDTWKQSTQRLRRGLPAFLRARRGRTLAKELEALREAKSHRPLIALPTQDPATHGGASSEASSD
Signal peptide: MGITAGKSMLALLAFLAFASCCYA
Modification: NA
Glycosylation: T14 O-linked (GalNAc...) threonine
Mutagenesis: NA

Function: Preptin undergoes glucose-mediated co-secretion with insulin, and acts as physiological amplifier of glucose-mediated insulin secretion. Exhibits osteogenic properties by increasing osteoblast mitogenic activity through phosphoactivation of MAPK1 and MAPK
Mechanism: The IGF2 locus is imprinted. Paternal inherited gene is expressed, while the maternal inherited gene is imprinted, hence silenced.
Cross BBB: NA
Target: IGF2R
Target Unid: W5P3H8
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor002163_AF2.pdb

hor002163_ESM.pdb

Mass:	442600	Formula:	C173H259N43O56
Absent amino acids:	CEHIMN	Common amino acids:	T
pI:	4.45	Basic residues:	3
Polar residues:	11	Hydrophobic residues:	11
Hydrophobicity:	-50.29	Boman Index:	-6632
Half-Life:	1.1 hour	Half-Life Yeast:	3 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	54.41
Instability Index:	3698.82	Extinction Coefficient cystines:	6990
Absorbance 280nm:	211.82